PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_282_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family BES1
Protein Properties Length: 371aa    MW: 39862.4 Da    PI: 8.9502
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_282_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822218.71.3e-67612111150
                              DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskp 75 
                                         g+sgr ptwkErEnnkrRERrRRaiaaki++GLRaqGnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp
  cra_locus_282_iso_1_len_1610_ver_3  61 GSSGRLPTWKERENNKRRERRRRAIAAKIFSGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEEDGTTYRKGCKP 135
                                         689************************************************************************ PP

                              DUF822  76 leeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvss 148
                                         +  +ea+++s+++s++sslq s+ ss+++spv+sy+asp+ss  psp++ d + +  +  + +lp+l++l+++++
  cra_locus_282_iso_1_len_1610_ver_3 136 P-PMEAGVASTNISTCSSLQPSPLSSSFPSPVPSYHASPSSSLCPSPTRGDGNGNGGNpsSYILPFLRNLASIPN 209
                                         *.*************************************************9988877789999*****999988 PP

                              DUF822 149 sl 150
                                         sl
  cra_locus_282_iso_1_len_1610_ver_3 210 SL 211
                                         75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.7E-6462204IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009741Biological Processresponse to brassinosteroid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
XQTPESSPKS LLSSALPLHT QPLLTLSEIH YSLYYLDSQT QEETGRGRPC AAGSRMTAAG  60
GSSGRLPTWK ERENNKRRER RRRAIAAKIF SGLRAQGNYK LPKHCDNNEV LKALCAEAGW  120
IVEEDGTTYR KGCKPPPMEA GVASTNISTC SSLQPSPLSS SFPSPVPSYH ASPSSSLCPS  180
PTRGDGNGNG GNPSSYILPF LRNLASIPNS LPPLRISNSA PVTPPLSSPT RGSKRKPEWE  240
PFSNVQLPSF PHNLFAASAP SSPTRRRHLK PATIPECDES DVSTVDSARW VSFQTTPAAP  300
SSPTFNLIKP ASKQNLPVDG CSQFAWGVAP QRGCGSEFAF ESGTIKAWEG ERAHEIGVDD  360
LELTLGSGKA H
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009349751.11e-139PREDICTED: BES1/BZR1 homolog protein 2-like
SwissprotQ94A431e-103BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLA0A068U2N41e-140A0A068U2N4_COFCA; Uncharacterized protein
STRINGVIT_04s0023g01250.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA94862128